PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018963-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family HB-other
Protein Properties Length: 528aa    MW: 59607.1 Da    PI: 8.182
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018963-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox42.51.1e-131868757
                   --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox  7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    t+ qle Le+++ +++yp+++ +e+ A+ l+Lt +qV+ WF  rR k+k+
  NNU_018963-RA 18 KTQFQLESLENFYSEEQYPTQAVMEDYATALNLTYKQVRGWFVERRRKDKR 68
                   5899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-13670IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-14873IPR009057Homeodomain-like
PROSITE profilePS5007114.058969IPR001356Homeobox domain
SMARTSM003894.0E-121173IPR001356Homeobox domain
CDDcd000868.79E-121770No hitNo description
PfamPF000465.9E-111868IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MGNDDVAKMK QKHGSKRKTQ FQLESLENFY SEEQYPTQAV MEDYATALNL TYKQVRGWFV  60
ERRRKDKREN EESGEASTVK VRSSMVFRKD GPPLGSEFDA LPAGAFHHCK AWLETLRVTS  120
GMKEATKGCG LQGLGFNRVE VEDDLQILIG WRKDISKSSN PDSQICKSAP VKKHGIGKGL  180
MTVWRATNPD AKGLPAGVNF TGIETGNIQP SLASSKSKKQ GREKRLQHQR LLETECNKDG  240
HPKRLHNVEC KLALEGLRSL EQPNELAVQV DDEELELREL QAGPNPLTCC DHLATNGIHG  300
CSLCKGLVLL SCILKERVIP SLKMEMGLSI TDKSYFILID LLARSFISCT LILWQLNCAP  360
LLLMSLLKHF MTRLVNRIFE LGLLDLPETE SHLVHMVHFI KDSLLLGKIH VSLLKLLLSD  420
VAIELSNGYL PRMSKDCRFL WFLHSVENQE FLVKFWNESL NPLTWTEVLR QILVAAGFGL  480
KQSTLRKEAL NKGLGLGWPR AELLMSYSSL AHEQLCLAWF KPCFEPDI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16166RRRKDK
26168RRRKDKRE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274901.10.0PREDICTED: uncharacterized protein LOC104610117 isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.12e-61Homeodomain-like transcriptional regulator